PDK1/PDHK1 Rabbit mAb, Clone: [ARC52376], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA8930P
Artikelname: PDK1/PDHK1 Rabbit mAb, Clone: [ARC52376], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA8930P
Hersteller Artikelnummer: CNA8930P
Alternativnummer: MBL-CNA8930P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 337-436 of human PDK1/PDHK1 (NP_002601.1).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC52376]
Molekulargewicht: 49kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: STAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 337-436 of human PDK1/PDHK1 (NP_002601.1).
Application Verdünnung: WB: WB,1:2000 - 1:10000|IHC-P,1:100 - 1:500