[KO Validated] SUCLG2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA8976T
Artikelname: [KO Validated] SUCLG2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA8976T
Hersteller Artikelnummer: CNA8976T
Alternativnummer: MBL-CNA8976T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 50-300 of human SUCLG2 (NP_003839.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 47kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SDNGVRVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFNSGLKGGVHLTKDPNVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIFEGIKDSQAQRMAENLGFVGPLKSQAADQITKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLD
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 50-300 of human SUCLG2 (NP_003839.2).
Application Verdünnung: WB: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:100