eIF4A3 Rabbit mAb, Clone: [ARC1373], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA8985S
Artikelname: eIF4A3 Rabbit mAb, Clone: [ARC1373], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA8985S
Hersteller Artikelnummer: CNA8985S
Alternativnummer: MBL-CNA8985S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 34-125 of human eIF4A3 (P38919).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1373]
Molekulargewicht: 47kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: VDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKG
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 34-125 of human eIF4A3 (P38919).
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200