MYO18A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA9015T
Artikelname: MYO18A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA9015T
Hersteller Artikelnummer: CNA9015T
Alternativnummer: MBL-CNA9015T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1970-2054 of human MYO18A (NP_510880.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 233kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SDVDSELEDRVDGVKSWLSKNKGPSKAASDDGSLKSSSPTSYWKSLAPDRSDDEHDPLDNTSRPRYSHSYLSDSDTEAKLTETNA
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1970-2054 of human MYO18A (NP_510880.2).
Application Verdünnung: WB: WB,1:1000 - 1:2000