SRSF3 Rabbit mAb, Clone: [ARC1394], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA9054S
Artikelname: SRSF3 Rabbit mAb, Clone: [ARC1394], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA9054S
Hersteller Artikelnummer: CNA9054S
Alternativnummer: MBL-CNA9054S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRSF3 (P84103).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1394]
Molekulargewicht: 19kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRP
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRSF3 (P84103).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200