MRPS25 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA9083T
Artikelname: |
MRPS25 Rabbit pAb, Unconjugated, Polyclonal |
Artikelnummer: |
MBL-CNA9083T |
Hersteller Artikelnummer: |
CNA9083T |
Alternativnummer: |
MBL-CNA9083T |
Hersteller: |
MBL |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Human |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 104-173 of human MRPS25 (NP_071942.1). |
Konjugation: |
Unconjugated |
Klonalität: |
Polyclonal |
Molekulargewicht: |
20kDa |
Puffer: |
PBS with 0.01% thimerosal,50% glycerol |
Quelle: |
Rabbit |
Reinheit: |
Affinity purification |
Formulierung: |
PBS with 0.01% thimerosal,50% glycerol |
Sequenz: |
KILGKNEETLREEEEEKKQLSHPANFGPRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD |
Target-Kategorie: |
Recombinant fusion protein containing a sequence corresponding to amino acids 104-173 of human MRPS25 (NP_071942.1). |
Application Verdünnung: |
WB: WB,1:500 - 1:2000 |