EPB41L2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA9101T
Artikelname: EPB41L2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA9101T
Hersteller Artikelnummer: CNA9101T
Alternativnummer: MBL-CNA9101T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human EPB41L2 (NP_001186317.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 113kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTLVVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKETQEDKLEGGAAKRETKEVQTNELKAEKASQK
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human EPB41L2 (NP_001186317.1).
Application Verdünnung: WB: WB,1:200 - 1:2000|IF/ICC,1:50 - 1:200