Carbonic Anhydrase 2 (CA2) Rabbit mAb, Clone: [ARC1451], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA9148S
Artikelname: Carbonic Anhydrase 2 (CA2) Rabbit mAb, Clone: [ARC1451], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA9148S
Hersteller Artikelnummer: CNA9148S
Alternativnummer: MBL-CNA9148S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 161-260 of human Carbonic Anhydrase 2 (CA2) (P00918).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1451]
Molekulargewicht: 29kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: DVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 161-260 of human Carbonic Anhydrase 2 (CA2) (P00918).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200