RPL26L1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA9192T
Artikelname: RPL26L1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA9192T
Hersteller Artikelnummer: CNA9192T
Alternativnummer: MBL-CNA9192T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-145 of human RPL26L1 (NP_057177.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 17kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEELIEKMQE
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-145 of human RPL26L1 (NP_057177.1).
Application Verdünnung: WB: WB,1:200 - 1:2000