CD82 Rabbit mAb, Clone: [ARC1501], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA9264S
Artikelname: CD82 Rabbit mAb, Clone: [ARC1501], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA9264S
Hersteller Artikelnummer: CNA9264S
Alternativnummer: MBL-CNA9264S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 168-267 of human CD82 (P27701).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1501]
Molekulargewicht: 30kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: PEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKVPKY
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 168-267 of human CD82 (P27701).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200