TAF15 Rabbit mAb, Clone: [ARC2765], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA9383S
Artikelname: TAF15 Rabbit mAb, Clone: [ARC2765], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA9383S
Hersteller Artikelnummer: CNA9383S
Alternativnummer: MBL-CNA9383S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 493-592 of human TAF15 (Q92804).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2765]
Molekulargewicht: 62kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: GYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSGYGGDRSGGYGGDRSGGGYGGDRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 493-592 of human TAF15 (Q92804).
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:100 - 1:500