MYL12B Rabbit mAb, Clone: [ARC2712], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA9387S
Artikelname: MYL12B Rabbit mAb, Clone: [ARC2712], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA9387S
Hersteller Artikelnummer: CNA9387S
Alternativnummer: MBL-CNA9387S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 73-172 of human MYL12B (O14950).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2712]
Molekulargewicht: 20kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 73-172 of human MYL12B (O14950).
Application Verdünnung: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200