Syntaxin 16 Rabbit mAb, Clone: [ARC2710], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA9405S
Artikelname: Syntaxin 16 Rabbit mAb, Clone: [ARC2710], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA9405S
Hersteller Artikelnummer: CNA9405S
Alternativnummer: MBL-CNA9405S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Syntaxin 16 (O14662).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2710]
Molekulargewicht: 37kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MATRRLTDAFLLLRNNSIQNRQLLAEQVSSHITSSPLHSRSIAAELDELADDRMALVSGISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELA
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Syntaxin 16 (O14662).
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200