Kallikrein 8 Rabbit mAb, Clone: [ARC2716], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA9409S
Artikelname: Kallikrein 8 Rabbit mAb, Clone: [ARC2716], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA9409S
Hersteller Artikelnummer: CNA9409S
Alternativnummer: MBL-CNA9409S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 161-260 of human Kallikrein 8 (O60259).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2716]
Molekulargewicht: 28kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: TSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 161-260 of human Kallikrein 8 (O60259).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200