PCBD1 Rabbit mAb, Clone: [ARC2749], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA9426S
Artikelname: PCBD1 Rabbit mAb, Clone: [ARC2749], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA9426S
Hersteller Artikelnummer: CNA9426S
Alternativnummer: MBL-CNA9426S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-104 of human PCBD1 (P61457).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2749]
Molekulargewicht: 12kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-104 of human PCBD1 (P61457).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200