MRP2/ABCC2 Rabbit mAb, Clone: [ARC1619], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA9528S
Artikelname: MRP2/ABCC2 Rabbit mAb, Clone: [ARC1619], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA9528S
Hersteller Artikelnummer: CNA9528S
Alternativnummer: MBL-CNA9528S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1446-1545 of human MRP2/ABCC2 (Q92887).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1619]
Molekulargewicht: 174kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: CLGRALLRKSKILVLDEATAAVDLETDNLIQTTIQNEFAHCTVITIAHRLHTIMDSDKVMVLDNGKIIECGSPEELLQIPGPFYFMAKEAGIENVNSTKF
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1446-1545 of human MRP2/ABCC2 (Q92887).
Application Verdünnung: WB: WB,1:500 - 1:1000