EYA1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA9534T
Artikelname: EYA1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA9534T
Hersteller Artikelnummer: CNA9534T
Alternativnummer: MBL-CNA9534T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human EYA1 (NP_000494.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 65kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: NSLTNSSGFNSSQQDYPSYPSFGQGQYAQYYNSSPYPAHYMTSSNTSPTTPSTNATYQLQEPPSGITSQAVTDPTAEYSTIHSPSTPIKDSDSDRLRRGSD
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human EYA1 (NP_000494.2).
Application Verdünnung: WB: WB,1:200 - 1:2000|IHC-P,1:50 - 1:200