CD172a/SIRPalpha Rabbit mAb, Clone: [ARC1626], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA9545S
Artikelname: CD172a/SIRPalpha Rabbit mAb, Clone: [ARC1626], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA9545S
Hersteller Artikelnummer: CNA9545S
Alternativnummer: MBL-CNA9545S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 395-495 of human CD172a/SIRPalpha (P78324).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1626]
Molekulargewicht: 55kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: RIRQKKAQGSTSSTRLHEPEKNAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSE
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 395-495 of human CD172a/SIRPalpha (P78324).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200