PSMB9/LMP2 Rabbit mAb, Clone: [ARC1629], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA9549S
Artikelname: PSMB9/LMP2 Rabbit mAb, Clone: [ARC1629], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA9549S
Hersteller Artikelnummer: CNA9549S
Alternativnummer: MBL-CNA9549S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 125-219 of human PSMB9/LMP2 (P28065).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1629]
Molekulargewicht: 23kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: QREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 125-219 of human PSMB9/LMP2 (P28065).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200