CYP2D6 Rabbit mAb, Clone: [ARC1635], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA9562S
Artikelname: CYP2D6 Rabbit mAb, Clone: [ARC1635], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA9562S
Hersteller Artikelnummer: CNA9562S
Alternativnummer: MBL-CNA9562S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 341-497 of human CYP2D6 (P10635).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1635]
Molekulargewicht: 56kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: QVRRPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSPSPYELCAVPR
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 341-497 of human CYP2D6 (P10635).
Application Verdünnung: WB: WB,1:1000 - 1:5000|IF/ICC,1:50 - 1:200