PAX5 Rabbit mAb, Clone: [ARC1654], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA9607S
Artikelname: PAX5 Rabbit mAb, Clone: [ARC1654], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA9607S
Hersteller Artikelnummer: CNA9607S
Alternativnummer: MBL-CNA9607S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PAX5 (Q02548).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1654]
Molekulargewicht: 42kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: DEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYP
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PAX5 (Q02548).
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IP,1:50 - 1:200