hnRNP Q/SYNCRIP Rabbit mAb, Clone: [ARC1656], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA9609S
Artikelname: hnRNP Q/SYNCRIP Rabbit mAb, Clone: [ARC1656], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA9609S
Hersteller Artikelnummer: CNA9609S
Alternativnummer: MBL-CNA9609S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 524-623 of human hnRNP Q/SYNCRIP (O60506).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1656]
Molekulargewicht: 70kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: SQRGGPGSARGVRGARGGAQQQRGRGVRGARGGRGGNVGGKRKADGYNQPDSKRRQTNNQNWGSQPIAQQPLQGGDHSGNYGYKSENQEFYQDTFGQQWK
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 524-623 of human hnRNP Q/SYNCRIP (O60506).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200