HIC1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA9651T
Artikelname: HIC1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA9651T
Hersteller Artikelnummer: CNA9651T
Alternativnummer: MBL-CNA9651T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 180-430 of human HIC1 (NP_001091672.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 77kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: AATPVIQACYPSPVGPPPPPAAEPPSGPEAAVNTHCAELYASGPGPAAALCASERRCSPLCGLDLSKKSPPGSAAPERPLAERELPPRPDSPPSAGPAAYKEPPLALPSLPPLPFQKLEEAAPPSDPFRGGSGSPGPEPPGRPDGPSLLYRWMKHEPGLGSYGDELGRERGSPSERCEERGGDAAVSPGGPPLGLAPPPRYPGSLDGPGAGGDGDDYKSSSEETGSSEDPSPPGGHLEGYPCPHLAYGEPE
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 180-430 of human HIC1 (NP_001091672.1).
Application Verdünnung: WB: WB,1:500 - 1:2000