CDK8 Rabbit mAb, Clone: [ARC1682], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA9654S
Artikelname: CDK8 Rabbit mAb, Clone: [ARC1682], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA9654S
Hersteller Artikelnummer: CNA9654S
Alternativnummer: MBL-CNA9654S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CDK8 (P49336).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1682]
Molekulargewicht: 53kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYA
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CDK8 (P49336).
Application Verdünnung: WB: WB,1:500 - 1:1000