SMN1 Rabbit mAb, Clone: [ARC1710], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA9707S
Artikelname: SMN1 Rabbit mAb, Clone: [ARC1710], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA9707S
Hersteller Artikelnummer: CNA9707S
Alternativnummer: MBL-CNA9707S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 103-200 of human SMN1 (Q16637).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1710]
Molekulargewicht: 32kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: SEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPM
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 103-200 of human SMN1 (Q16637).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200