RPB3/POLR2C Rabbit mAb, Clone: [ARC1729], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA9744S
Artikelname: RPB3/POLR2C Rabbit mAb, Clone: [ARC1729], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA9744S
Hersteller Artikelnummer: CNA9744S
Alternativnummer: MBL-CNA9744S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RPB3/POLR2C (P19387).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1729]
Molekulargewicht: 31kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHDEFIAHRLGLIPLISDDIVDKLQYSRDCTCEEFCPECSVE
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RPB3/POLR2C (P19387).
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200