TIN2/TINF2 Rabbit mAb, Clone: [ARC1732], Unconjugated, Monoclonal
Artikelnummer:
MBL-CNA9750S
| Artikelname: |
TIN2/TINF2 Rabbit mAb, Clone: [ARC1732], Unconjugated, Monoclonal |
| Artikelnummer: |
MBL-CNA9750S |
| Hersteller Artikelnummer: |
CNA9750S |
| Alternativnummer: |
MBL-CNA9750S |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 210-309 of human TIN2/TINF2 (Q9BSI4). |
| Konjugation: |
Unconjugated |
| Klonalität: |
Monoclonal |
| Klon-Bezeichnung: |
[ARC1732] |
| Molekulargewicht: |
50kDa |
| Puffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Sequenz: |
NLAEPMEQNPPQQQRLALHNPLPKAKPGTHLPQGPSSRTHPEPLAGRHFNLAPLGRRRVQSQWASTRGGHKERPTVMLFPFRNLGSPTQVISKPESKEEH |
| Target-Kategorie: |
Recombinant fusion protein containing a sequence corresponding to amino acids 210-309 of human TIN2/TINF2 (Q9BSI4). |
| Application Verdünnung: |
WB: WB,1:500 - 1:1000 |
