GUCA2A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA9820S
Artikelname: GUCA2A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA9820S
Hersteller Artikelnummer: CNA9820S
Alternativnummer: MBL-CNA9820S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 22-115 of human GUCA2A (NP_291031.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 12kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: VTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 22-115 of human GUCA2A (NP_291031.2).
Application Verdünnung: WB: WB,1:500 - 1:2000