PTK7 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA9839S1
Artikelname: PTK7 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA9839S1
Hersteller Artikelnummer: CNA9839S1
Alternativnummer: MBL-CNA9839S1
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 811-1070 of human PTK7 (NP_002812.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 118kDa
Puffer: PBS with 0.09% Sodium azide,50% glycerol
Quelle: Rabbit
Sequenz: FLAKAQGLEEGVAETLVLVKSLQSKDEQQQLDFRRELEMFGKLNHANVVRLLGLCREAEPHYMVLEYVDLGDLKQFLRISKSKDEKLKSQPLSTKQKVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKARLPQPEGCPSKLYRLMQRCWALSPKDRPSFSEIASALGDS
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 811-1070 of human PTK7 (NP_002812.2).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:100