Phospho-VANGL2-S79/S82/S84 Rabbit mAb, Clone: [ARC5022], Unconjugated, Monoclonal

Artikelnummer: MBL-CNAP1207P
Artikelname: Phospho-VANGL2-S79/S82/S84 Rabbit mAb, Clone: [ARC5022], Unconjugated, Monoclonal
Artikelnummer: MBL-CNAP1207P
Hersteller Artikelnummer: CNAP1207P
Alternativnummer: MBL-CNAP1207P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: A phospho specific peptide corresponding to residues surrounding S79/S82/S84 of human VANGL2
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC5022]
Molekulargewicht: 60kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: RDDNWGETTTVVTGTSEHSISHDDLTRIAKDMEDSVPLDC
Target-Kategorie: A phospho specific peptide corresponding to residues surrounding S79/S82/S84 of human VANGL2
Application Verdünnung: WB: WB,1:500 - 1:1000