Anti-EIF4E pAb, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: Anti-EIF4E pAb, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: MBL-RN001P
• Hersteller Artikelnummer: RN001P
• Alternativnummer: MBL-RN001P
• Hersteller: MBL
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IP, WB
• Spezies Reaktivität: Hamster, Human, Mouse, Rat
• Immunogen: KLH-conjugated synthetic peptide MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKH (1-37 a.a.)
• Konjugation: Unconjugated

Produktbeschreibung

RIP-CERTIFIED ANTIBODY: Posttranscriptional regulation of gene expression is a ribonucleoprotein-driven process, which involves RNA binding proteins (RBPs) and non-coding RNAs that affect splicing, nuclear export, subcellular localization, mRNA decay and

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 1 mg/mL
• NCBI: 1977
• Puffer: 200 µl volume of PBS containing 50% glycerol, pH 7.2. No preservative is contained.
• Quelle: This antibody was purified from rabbit serum by affinity column chromatography. The rabbit was immunized with KLH conjugated synthetic peptide, MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKH corresponding to 1-37 aa.
• Target-Kategorie: EIF4E

Anwendungsbeschreibung

• Application Verdünnung: WB: 1:1,000 for chemiluminescence detection system. IP: 5 µg/250 µL of cell extract from 2.5 x 106 cells. RIP: 15 µg/500 µL of cell extract from 4.5 x 106 cells