RIP-CERTIFIED ANTIBODY: Posttranscriptional regulation of gene expression is a ribonucleoprotein-driven process, which involves RNA binding proteins (RBPs) and non-coding RNAs that affect splicing, nuclear export, subcellular localization, mRNA decay and
200 µl volume of PBS containing 50% glycerol, pH 7.2. No preservative is contained.
Quelle:
This antibody was purified from rabbit serum by affinity column chromatography. The rabbit was immunized with KLH conjugated synthetic peptide, MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKH corresponding to 1-37 aa.
Target-Kategorie:
EIF4E
Application Verdünnung:
WB: 1:1,000 for chemiluminescence detection system. IP: 5 µg/250 µL of cell extract from 2.5 x 106 cells. RIP: 15 µg/500 µL of cell extract from 4.5 x 106 cells
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten