PMAP-36, CAS [[154338-08-6]] Preis auf Anfrage
Artikelnummer:
MCE-HY-P10158
| Artikelname: |
PMAP-36, CAS [[154338-08-6]] Preis auf Anfrage |
| Artikelnummer: |
MCE-HY-P10158 |
| Hersteller Artikelnummer: |
HY-P10158 |
| Alternativnummer: |
MCE-HY-P10158-1UNIT |
| Hersteller: |
MedchemExpress |
| Kategorie: |
Proteine/Peptide |
| Alternative Synonym: |
Porcine cathelicidin PMAP-36 |
| PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. PMAP-36 with traditional antibiotics can enhance[1]. |
| Molekulargewicht: |
4157.17 |
| CAS Nummer: |
[154338-08-6] |
| Formel: |
C191H336N62O39S |
| Target-Kategorie: |
Bacterial |
| Anwendungsbeschreibung: |
Peptides |
