SARS-CoV-2 (COVID-19) NSP5A Protein, His Tag is produced in E. coli and has a theoretical molecular weight of 34.6KD. This product is for research use only., Clone: [5G4], Unconjugated, Monoclonal

Produktübersicht

• Artikelname: SARS-CoV-2 (COVID-19) NSP5A Protein, His Tag is produced in E. coli and has a theoretical molecular weight of 34.6KD. This product is for research use only., Clone: [5G4], Unconjugated, Monoclonal
• Artikelnummer: NBS-RBB-6FNETF-100
• Hersteller Artikelnummer: RBB-6FNETF-100
• Alternativnummer: NBS-RBB-6FNETF-100
• Hersteller: Nordic BioSite
• Kategorie: Antikörper
• Spezies Reaktivität: Mouse
• Immunogen: 1-245aa
• Konjugation: Unconjugated
• Alternative Synonym: covid-19, sars-cov-2

Produktbeschreibung

SARS-CoV-2 (COVID-19) NSP5A Protein, His Tag is produced in E. coli and has a theoretical molecular weight of 34.6KD. This product is for research use only. Product is under validation for additional applications and indications. If youre interested, ple

Produkteigenschaften

• Klonalität: Monoclonal
• Konzentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Klon-Bezeichnung: [5G4]
• Molekulargewicht: 34.6KD
• Detektionsbereich: 31.2pg/ml-2000pg/ml
• Sensitivitaet: <10pg/ml
• NCBI: 7124
• UniProt: P01375
• Puffer: Lyophilized from sterile 20mM PB, 150mM NaCl, PH 7.3-7.4, 10% glycerol and 4% trehalose
• Reinheit: >90%
• Formulierung: Lyophilized
• Sequenz: SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLS