SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag is produced in E. coli and has a theoretical molecular weight of 13.2KD. This product is for research use only., Clone: [5G4], Unconjugated, Monoclonal

Artikelnummer: NBS-RBB-SOCSN6-100
Artikelname: SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag is produced in E. coli and has a theoretical molecular weight of 13.2KD. This product is for research use only., Clone: [5G4], Unconjugated, Monoclonal
Artikelnummer: NBS-RBB-SOCSN6-100
Hersteller Artikelnummer: RBB-SOCSN6-100
Alternativnummer: NBS-RBB-SOCSN6-100
Hersteller: Nordic BioSite
Kategorie: Antikörper
Spezies Reaktivität: Mouse
Immunogen: 1-245aa
Konjugation: Unconjugated
Alternative Synonym: covid-19, sars-cov-2
SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag is produced in E. coli and has a theoretical molecular weight of 13.2KD. This product is for research use only. Product is under validation for additional applications and indications. If youre interested, plea
Klonalität: Monoclonal
Konzentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Klon-Bezeichnung: [5G4]
Molekulargewicht: 13.2KD
Detektionsbereich: 31.2pg/ml-2000pg/ml
Sensitivitaet: <10pg/ml
NCBI: 7124
UniProt: P01375
Puffer: Lyophilized from sterile 20mM PB, 150mM NaCl, PH 7.3-7.4, 10% glycerol and 4% trehalose
Reinheit: >90%
Formulierung: Lyophilized
Sequenz: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ