SARS-CoV-2 (COVID-19) NSP8 Protein, His Tag is produced in E. coli and the theoretical molecular weight is 22.7KD. This product is for research use only., Clone: [5G4], Unconjugated, Monoclonal

Produktübersicht

• Artikelname: SARS-CoV-2 (COVID-19) NSP8 Protein, His Tag is produced in E. coli and the theoretical molecular weight is 22.7KD. This product is for research use only., Clone: [5G4], Unconjugated, Monoclonal
• Artikelnummer: NBS-RBB-VUK247-100
• Hersteller Artikelnummer: RBB-VUK247-100
• Alternativnummer: NBS-RBB-VUK247-100
• Hersteller: Nordic BioSite
• Kategorie: Antikörper
• Spezies Reaktivität: Mouse
• Immunogen: 1-245aa
• Konjugation: Unconjugated
• Alternative Synonym: covid-19, sars-cov-2

Produktbeschreibung

SARS-CoV-2 (COVID-19) NSP8 Protein, His Tag is produced in E. coli and the theoretical molecular weight is 22.7KD. This product is for research use only. Product is under validation for additional applications and indications. If youre interested, please

Produkteigenschaften

• Klonalität: Monoclonal
• Konzentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Klon-Bezeichnung: [5G4]
• Molekulargewicht: 22.7KD
• Detektionsbereich: 31.2pg/ml-2000pg/ml
• Sensitivitaet: <10pg/ml
• NCBI: 7124
• UniProt: P01375
• Puffer: Lyophilized from sterile 20mM PB, 150mM NaCl, PH 7.3-7.4, 10% glycerol and 4% trehalose
• Reinheit: >90%
• Formulierung: Lyophilized
• Sequenz: AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ