SARS-CoV-2 Antibody (ORF3a), Rabbit, Polyclonal

Artikelnummer: NSJ-RQ6295
Artikelname: SARS-CoV-2 Antibody (ORF3a), Rabbit, Polyclonal
Artikelnummer: NSJ-RQ6295
Hersteller Artikelnummer: RQ6295
Alternativnummer: NSJ-RQ6295
Hersteller: NSJ Bioreagents
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA
Spezies Reaktivität: Human
Immunogen: Amino acids MDLFMRIFTIGTVTLKQGEIKDATPSDFVRATATIPIQASggggFQSASKIITLKKRWQLALSKGVHFVCNLggggQSINFVRIIMRLWLCWKCRSKNPLLYDANYFLCWHTNCYDYC
IPYNSVTSSIVITSGDGTTSPISEHDYQIGGYTEKWESGVKDCVVLHSYFTSDYYQLYSTQLSTDTGVEHVTFFIYNKIVDEPEEHVQIHTIDGSSGVVNPVMEPIYDEPTTTTSVPL w
Alternative Synonym: sars-cov-2
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for i
Klonalität: Polyclonal
Konzentration: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Isotyp: Rabbit IgG
UniProt: P0DTC3
Puffer: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Reinheit: Affinity purified
Formulierung: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Target-Kategorie: SARS-CoV-2
Antibody Type: Primary Antibody
Application Verdünnung: ELISA
Anwendungsbeschreibung: Optimal dilution of the SARS-CoV-2 ORF3a antibody should be determined by the researcher.