SARS-CoV-2 Antibody (NSP12 / RNA polymerase), Rabbit, Polyclonal

Artikelnummer: NSJ-RQ6306
Artikelname: SARS-CoV-2 Antibody (NSP12 / RNA polymerase), Rabbit, Polyclonal
Artikelnummer: NSJ-RQ6306
Hersteller Artikelnummer: RQ6306
Alternativnummer: NSJ-RQ6306
Hersteller: NSJ Bioreagents
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA
Spezies Reaktivität: Human
Immunogen: Amino acids SADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVP
HISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKggggDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELT
GHMLDMY
Alternative Synonym: sars-cov-2
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for i
Klonalität: Polyclonal
Konzentration: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Isotyp: Rabbit IgG
UniProt: P0DTD1
Puffer: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Reinheit: Affinity purified
Formulierung: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Target-Kategorie: SARS-CoV-2
Antibody Type: Primary Antibody
Application Verdünnung: ELISA
Anwendungsbeschreibung: Optimal dilution of the SARS-CoV-2 RNA polymerase antibody should be determined by the researcher.