Transferrin Antibody / TF, Clone: [7I11B10], Mouse, Monoclonal

Produktübersicht

• Artikelname: Transferrin Antibody / TF, Clone: [7I11B10], Mouse, Monoclonal
• Artikelnummer: NSJ-RQ7657
• Hersteller Artikelnummer: RQ7657
• Alternativnummer: NSJ-RQ7657
• Hersteller: NSJ Bioreagents
• Wirt: Mouse
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: Amino acids 20-49 (VPDKTVRWCAVSEHEATKCQSFRDHMKSVI) from the human protein were used as the immunogen for the Transferrin antibody.

Produktbeschreibung

Transferrins are iron-binding blood plasma glycoproteins that control the level of free iron in biological fluids. In humans, it is encoded by the TF gene. Transferrin consists of a polypeptide chain containing 679 amino acids in humans. The protein is c

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [7I11B10]
• UniProt: P02787
• Puffer: Lyophilized from 1X PBS with 2% Trehalose
• Reinheit: Antigen affinity purified
• Formulierung: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: Western blot: 0.5-1ug/ml
• Anwendungsbeschreibung: Optimal dilution of the Transferrin antibody should be determined by the researcher.