LL - 37

Artikelnummer: PEL-EP11651_1
Artikelname: LL - 37
Artikelnummer: PEL-EP11651_1
Hersteller Artikelnummer: EP11651_1
Alternativnummer: PEL-EP11651_1
Hersteller: peptides and elephants
Kategorie: Proteine/Peptide
The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18). Antimicrobial peptide LL-37,i belongsi to the cathelicidin family of peptides, and this peptide corresponds to the sequence
Reinheit: 95%
Sequenz: [LL-37, 37 aa]