LL - 37

Artikelnummer: PEL-EP11651_5
Artikelname: LL - 37
Artikelnummer: PEL-EP11651_5
Hersteller Artikelnummer: EP11651_5
Alternativnummer: PEL-EP11651_5
Hersteller: peptides and elephants
Kategorie: Proteine/Peptide
Alternative Synonym: other name: Baculoviral IAP repeat-containing protein 7 (280-289), ML-IAP 280-289
The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18). Antimicrobial peptide LL-37,i belongsi to the cathelicidin family of peptides, and this peptide corresponds to the sequence
Reinheit: 95%
Sequenz: [LL-37, 37 aa]