SARS-CoV-2 (COVID-19) ORF7a protein polyclonal antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
PRS-11-048
Artikelname: |
SARS-CoV-2 (COVID-19) ORF7a protein polyclonal antibody, Unconjugated, Rabbit, Polyclonal |
Artikelnummer: |
PRS-11-048 |
Hersteller Artikelnummer: |
11-048 |
Alternativnummer: |
PRS-11-048-0.1 |
Hersteller: |
ProSci |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
ELISA |
Spezies Reaktivität: |
Virus |
Immunogen: |
MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE |
Konjugation: |
Unconjugated |
Alternative Synonym: |
Accessory protein 7a, ORF7a protein, Protein U122, Protein X4, covid-19, sars-cov-2 |
Klonalität: |
Polyclonal |
Konzentration: |
batch dependent |
Puffer: |
PBS, pH7.4, containing 0.05% proclin300, 50% glycerol. |
Formulierung: |
Liquid |
Application Verdünnung: |
Optimal dilutions for each application to be determined by the researcher. |
Anwendungsbeschreibung: |
Elisa:1:4000~1:8000 |