SARS-CoV-2 (COVID-19) ORF8 protein polyclonal antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
PRS-11-049
| Artikelname: |
SARS-CoV-2 (COVID-19) ORF8 protein polyclonal antibody, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
PRS-11-049 |
| Hersteller Artikelnummer: |
11-049 |
| Alternativnummer: |
PRS-11-049-0.1 |
| Hersteller: |
ProSci |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
ELISA |
| Spezies Reaktivität: |
Virus |
| Immunogen: |
MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
Non-structural protein 8, ORF8 protein, covid-19, ns8, sars-cov-2 |
| Klonalität: |
Polyclonal |
| Konzentration: |
batch dependent |
| Puffer: |
PBS, pH7.4, containing 0.05% proclin300, 50% glycerol. |
| Formulierung: |
Liquid |
| Application Verdünnung: |
Optimal dilutions for each application to be determined by the researcher. |
| Anwendungsbeschreibung: |
Elisa:1:4000~1:8000 |
