Recombinant Human CCL5
Artikelnummer:
QBS-50181P-100
Artikelname: |
Recombinant Human CCL5 |
Artikelnummer: |
QBS-50181P-100 |
Hersteller Artikelnummer: |
50181P-100 |
Alternativnummer: |
QBS-50181P-100-100 |
Hersteller: |
QED Bioscience |
Kategorie: |
Proteine/Peptide |
Spezies Reaktivität: |
Human |
Alternative Synonym: |
rHuCCL5 |
Recombinant human CCL5, produced in E. coli, corresponds to aa 24-91 |
Konzentration: |
Lot Specific |
Molekulargewicht: |
7.851 kDa |
UniProt: |
P13501 |
Quelle: |
Recombinant human CCL5, produced in E. coli |
Reinheit: |
>97% |
Formulierung: |
Lyophilized. |
Sequenz: |
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQV CANPEKKWVREYINSLEMS |
Target-Kategorie: |
CCL5 |
Antibody Type: |
Recombinant Antibody |
Application Verdünnung: |
Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water. |