Recombinant Human CCL5
Artikelnummer:
QBS-50181P-5
| Artikelname: |
Recombinant Human CCL5 |
| Artikelnummer: |
QBS-50181P-5 |
| Hersteller Artikelnummer: |
50181P-5 |
| Alternativnummer: |
QBS-50181P-5-5 |
| Hersteller: |
QED Bioscience |
| Kategorie: |
Proteine/Peptide |
| Spezies Reaktivität: |
Human |
| Alternative Synonym: |
rHuCCL5 |
| Recombinant human CCL5, produced in E. coli, corresponds to aa 24-91 |
| Konzentration: |
Lot Specific |
| Molekulargewicht: |
7.851 kDa |
| UniProt: |
P13501 |
| Quelle: |
Recombinant human CCL5, produced in E. coli |
| Reinheit: |
>97% |
| Formulierung: |
Lyophilized. |
| Sequenz: |
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQV CANPEKKWVREYINSLEMS |
| Target-Kategorie: |
CCL5 |
| Antibody Type: |
Recombinant Antibody |
| Application Verdünnung: |
Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water. |
