Recombinant Human CCL5, biotinylated, Biotin
Artikelnummer:
QBS-50181PB-10
Artikelname: |
Recombinant Human CCL5, biotinylated, Biotin |
Artikelnummer: |
QBS-50181PB-10 |
Hersteller Artikelnummer: |
50181PB-10 |
Alternativnummer: |
QBS-50181PB-10-10 |
Hersteller: |
QED Bioscience |
Kategorie: |
Proteine/Peptide |
Spezies Reaktivität: |
Human |
Konjugation: |
Biotin |
Alternative Synonym: |
rHuCCL5-biotin, Rantes |
Recombinant human CCL5, produced in E. coli, corresponds to aa 24-91 |
Konzentration: |
Lot Specific |
UniProt: |
P13501 |
Quelle: |
Recombinant human CCL5, produced in E. coli |
Reinheit: |
>97% by SDS-PAGE |
Formulierung: |
Lyophilized. |
Sequenz: |
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQV CANPEKKWVREYINSLEMS |
Target-Kategorie: |
CCL5ylated |
Antibody Type: |
Recombinant Antibody |
Application Verdünnung: |
Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water. |