Recombinant Human CCL5, biotinylated, Biotin

Artikelnummer: QBS-50181PB-100
Artikelname: Recombinant Human CCL5, biotinylated, Biotin
Artikelnummer: QBS-50181PB-100
Hersteller Artikelnummer: 50181PB-100
Alternativnummer: QBS-50181PB-100-100
Hersteller: QED Bioscience
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Biotin
Alternative Synonym: rHuCCL5-biotin, Rantes
Recombinant human CCL5, produced in E. coli, corresponds to aa 24-91
Konzentration: Lot Specific
UniProt: P13501
Quelle: Recombinant human CCL5, produced in E. coli
Reinheit: >97% by SDS-PAGE
Formulierung: Lyophilized.
Sequenz: SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQV CANPEKKWVREYINSLEMS
Target-Kategorie: CCL5ylated
Antibody Type: Recombinant Antibody
Application Verdünnung: Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water.