Recombinant Human CCL27

Artikelnummer: QBS-50182P-5
Artikelname: Recombinant Human CCL27
Artikelnummer: QBS-50182P-5
Hersteller Artikelnummer: 50182P-5
Alternativnummer: QBS-50182P-5-5
Hersteller: QED Bioscience
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: rHuCCL27, CTACK
Recombinant human CCL27, produced in E. coli, corresponds to aa 25- 112
Konzentration: Lot Specific
Molekulargewicht: 10.149 kDa
UniProt: Q9Y4X3
Quelle: Recombinant human CCL27, produced in E. coli
Reinheit: >97%
Formulierung: Lyophilized.
Sequenz: FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQ RSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
Target-Kategorie: CCL27
Antibody Type: Recombinant Antibody
Application Verdünnung: Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water.