Recombinant Human CCL28

Artikelnummer: QBS-50183P-100
Artikelname: Recombinant Human CCL28
Artikelnummer: QBS-50183P-100
Hersteller Artikelnummer: 50183P-100
Alternativnummer: QBS-50183P-100-100
Hersteller: QED Bioscience
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: rHuCCL28, MEC
Recombinant human CCL28, produced in E. coli, corresponds to aa 23- 127
Konzentration: Lot Specific
Molekulargewicht: 12.073 kDa
UniProt: Q9NRJ3
Quelle: Recombinant human CCL28, produced in E. coli
Reinheit: >97%
Formulierung: Lyophilized.
Sequenz: ILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRR ICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQG KHETYGHKTPY
Target-Kategorie: CCL28
Antibody Type: Recombinant Antibody
Application Verdünnung: Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water.