Recombinant Human CCL28, biotinylated, Biotin

Artikelnummer: QBS-50183PB-10
Artikelname: Recombinant Human CCL28, biotinylated, Biotin
Artikelnummer: QBS-50183PB-10
Hersteller Artikelnummer: 50183PB-10
Alternativnummer: QBS-50183PB-10-10
Hersteller: QED Bioscience
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Biotin
Alternative Synonym: rHuCCL28-biotin, MEC
Recombinant human CCL28, produced in E. coli, corresponds to aa 23- 127
Konzentration: Lot Specific
Molekulargewicht: 14.3 kDa
UniProt: Q9NRJ3
Quelle: Recombinant human CCL28, produced in E. coli
Reinheit: >97%
Formulierung: Lyophilized.
Sequenz: ILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRR ICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQG KHETYGHKTPY
Target-Kategorie: CCL28ylated
Antibody Type: Recombinant Antibody
Application Verdünnung: Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water.