VSGLNPSLWSIFGLQFILLWLVSGSRHYLW, CAS [[2279952-25-7]] Preis auf Anfrage

Produktübersicht

• Artikelname: VSGLNPSLWSIFGLQFILLWLVSGSRHYLW, CAS [[2279952-25-7]] Preis auf Anfrage
• Artikelnummer: TGM-T76250
• Hersteller Artikelnummer: T76250
• Alternativnummer: TGM-T76250-5MG, TGM-T76250-50MG
• Hersteller: TargetMol
• Kategorie: Biochemikalien

Produktbeschreibung

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW, a 30-amino-acid peptide, mirrors the C-terminal domain of alpha2delta-1 and is recognized as the alpha2delta-1Tat peptide. It disrupts the alpha2delta-1 - NMDAR interaction both in vitro and in vivo, offering a potential research tool for neuropa

Produkteigenschaften

• Molekulargewicht: 3490.06
• CAS Nummer: [2279952-25-7]
• Formel: C171H250N40O39